PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00543.1.g00260.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 369aa    MW: 38748.2 Da    PI: 7.1458
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00543.1.g00260.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY29.81.2e-09152171221
                                   --SS-EEEEEEE--TT-SS- CS
                          WRKY   2 dDgynWrKYGqKevkgsefp 21 
                                   +Dg++WrKYGqK++k++++p
  Zpz_sc00543.1.g00260.1.am.mk 152 SDGFKWRKYGQKSIKNNPYP 171
                                   7******************9 PP

2WRKY48.12.3e-152062412358
                                   EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                          WRKY  23 sYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                                   sYY+Cts++C +kk+ve+s +dp+++++tYeg H h
  Zpz_sc00543.1.g00260.1.am.mk 206 SYYKCTSSRCGAKKHVEKSVDDPEMLIVTYEGPHLH 241
                                   9*********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-25145171IPR003657WRKY domain
PROSITE profilePS5081119.933146244IPR003657WRKY domain
SuperFamilySSF1182902.62E-7149172IPR003657WRKY domain
SMARTSM007743.9E-26151243IPR003657WRKY domain
PfamPF031062.1E-6153172IPR003657WRKY domain
SuperFamilySSF1182901.16E-11203243IPR003657WRKY domain
PfamPF031067.5E-11204241IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-25205242IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MTGYALPGDE ATTDGAAALW PGELDEQLIS ELLSDDSLLG PLHGPAGDSA HYCSGDAGPV  60
DAAAPTPCNS GGDGTAAERE VPQPAAVNRA LCSVYSGPTI QDIEKALSSS RPCHWMSNRR  120
YSSSIGRFGA TSTAPESKYT TKVRTCAGKM PSDGFKWRKY GQKSIKNNPY PSVGRRLYDR  180
SLHIRVVVRC RALVDKIGMA ECCGWSYYKC TSSRCGAKKH VEKSVDDPEM LIVTYEGPHL  240
HGPQPPFPRR QWTSADFLSG AAATRRGAEA PSPPLTASSG GAHPNNQPHT CDAAAGARGG  300
GVSVVADGRE NGRAEADVVV KATRSCDGCS GASVAAPGDG TALPCDSPPT TWSCPNSYFS  360
SWSLEALLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1016163e-43FP101616.1 Phyllostachys edulis cDNA clone: bphyem119j23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970545.12e-92PREDICTED: uncharacterized protein LOC101763814 isoform X1
TrEMBLC5XPQ32e-83C5XPQ3_SORBI; Putative uncharacterized protein Sb03g039550
STRINGSb03g039550.17e-83(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131442633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.18e-25WRKY DNA-binding protein 49